splunk

SoftwareOne in Istanbul offers a hybrid work model and seeks a Lead Information Security Consultant to design, implement, and optimize Splunk-based solutions for enterprise customers within the Security Services team.You will support deployments, address technical and business requirements, and collaborate with customers and internal teams to ensure...

SoftwareONE Deutschland GmbH is seeking a Splunk Architect in Istanbul, Turkey, to design and deploy scalable Splunk solutions. You will manage Splunk deployments and configurations, providing technical guidance to customers while troubleshooting integration issues.A proven track record as a Splunk Architect or Consultant and deep knowledge of Splunk...

Meet the Team Drives technical leadership and innovation within the Splunk security ecosystem, serving as a trusted advisor for sophisticated, multi-functional security initiatives at regional and global scale. Leads the compose, planning, and delivery of tailored Splunk solutions—including SIEM, SOAR, and AI-driven security operations—that address...

Practical Information Location: Istanbul, Turkey | Reports to: CTO | Work Arrangement: Hybrid | Visa Requirements: Valid working visa for Turkey | Language Requirements: Good command of English, written and spoken Key Responsibilities Design and implement scalable Splunk architectures based on customer requirements Lead Splunk deployment, configuration,...

Are you looking to design and deliver enterprise-level solutions?Do you enjoy collaborating with customers, internal teams, and project stakeholders to implement and optimize Splunk solutions?Want to be part of a leading global software and cloud solutions provider, helping organizations run and optimize their IT environments?Practical InformationLocation:...

We are looking for a Senior AWS DevOps Engineer to set up AWS infrastructure and GitLab (DXOne) environments to support AWS migrations, including re-platforming, refactoring, and rearchitecting initiatives. Responsibilities Set up and configure AWS infrastructure to support migration projects Create and configure virtual machines according to best...

Soitron Siber Güvenlik Servisleri A.Ş. İstanbul’da SOC Analisti arıyor. Pozisyon, Void SOC bünyesinde Türkiye’deki SOC müdürüne bağlı olarak çalışacaktır ve 7x24 vardiya ile altyapıları izlemek üzere tasarlanmıştır.İşe alınacak aday, 1 yıl deneyime sahip olabilir ve QRadar/Splunk/XSOAR gibi çözümlere ilgi gösterecektir. İyi...

Would you like to perform rewarding work while contributing to the success of an established, growing company?We are looking for a Senior Java Developer with expertise in payment systems to join our team and lead high-impact projects in the financial services domain.QualificationsBachelor’s degree in Computer Engineering, Software Engineering, Mathematics...

Executive SummaryTreomind seeks a senior AI Security Operations Engineer responsible for continuous monitoring, detection, response, governance, and operational security of enterprise AI systems. The role combines AI Security, SOC operations, cloud security, threat detection, telemetry analysis, dashboarding, and consulting expertise.Core MissionMonitor AI...

Executive Summary Treomind seeks a senior AI Security Operations Engineer responsible for continuous monitoring, detection, response, governance, and operational security of enterprise AI systems. The role combines AI Security, SOC operations, cloud security, threat detection, telemetry analysis, dashboarding, and consulting expertise. Core Mission Monitor...

We are looking for a Senior Azure DevOps Engineer to spearhead a high-impact enterprise digital transformation initiative, driving the massive migration and modernization of a hybrid infrastructure. This role centers on the complex re-platforming and automation of 20+ mission-critical, large-scale Java and .NET ecosystems, transitioning them from legacy...

Istanbul • Soitron Siber Güvenlik Servisleri / SOC • Tam ZamanlıSoitronekibinekatılaraksibergüvenliktekariyeryapmakisteyenadaylarınbaşvurularınıbekliyoruz.Soitron Siber Güvenlik Servisleri A.Ş.,Avrupa merkezli bilgi teknolojileri firması Soitron Group'un Türkiye’deki siber güvenlik şirketidir. Soitron olarak müşterilerimize kapsamlı...

Bu hedefimize birlikte yürüyecek Senior Cyber Security Engineer arıyoruz. İş Tanımı SIEM, DAM vb. merkezi log yönetim platformlarının kurulum / tasarım, yönetim ve operasyonlarından sorumlu olmak. Merkezi log yönetim platformları için güvenlik operasyonları, regülasyon ve mevzuat kapsamında tutulması gereken loglar için standartları...

· Installation, configuration, deployment, administration and monitoring of IBM API Connect in Cloud and On Prem VMs. · Monitor the health of the IBM API Connect environment to ensure performance and availability of APIs. · Participate, and lead as necessary, in incident resolution calls when needed to assist root cause analysis of issues. · Analyze logs...

We are looking for DevOps Engineer to join our fast-paced and self-accountable team that delivers enterprise-level products for local and global markets. You will work with IT consultants, delivery managers, QA teams, BE, FE, and mobile developers to deliver best-in-class digital products. where you can code, grow, and inspire others. What will you...

Get ready to take your place on n11, an open market platform has made valuable contributions to the e-commerce sector since its establishment by bringing more than 330 thousand registered business partners to customers. We are looking for "Site Reliability Manager" to join our team in Technology/Infrastructure Department. What you’ll do: Provide guidance...

Posting Title Cybersecurity Engineer Location Remote Position Type Regular Hours Per Week 40 Working at NLR Join the National Laboratory of the Rockies (NLR), where world-class scientists, engineers, and experts are accelerating energy innovation through breakthrough research and systems integration. From our mission to our collaborative culture,...

iyzico iyzico was founded in 2013 to provide online payment services and artificial intelligence-based payment technologies to businesses of various sizes in the world of e-commerce. By making the complex payment processes simple through its easy and secure platform, iyzico had achieved significant successes through supporting thousands of businesses in...

We're looking for a talented and driven Lead AWS DevOps Engineer to become part of our team. We want someone who brings solid, practical expertise in AWS cloud platforms, building CI/CD pipelines, automating infrastructure, and integrating systems. The person in this position should feel at home collaborating with development, operations, and infrastructure...

Get AI-powered advice on this job and more exclusive features.OBSS is Turkey’s largest technology consultancy, pioneering product development and technology consulting for an AI-native future. With more than 20 years of experience and offices in Istanbul, Ankara, London, Amsterdam, and Baku, we empower leading companies in banking and finance, insurance,...