splunk

SoftwareOne in Istanbul offers a hybrid work model and seeks a Lead Information Security Consultant to design, implement, and optimize Splunk-based solutions for enterprise customers within the Security Services team.You will support deployments, address technical and business requirements, and collaborate with customers and internal teams to ensure...

SoftwareONE Deutschland GmbH is seeking a Splunk Architect in Istanbul, Turkey, to design and deploy scalable Splunk solutions. You will manage Splunk deployments and configurations, providing technical guidance to customers while troubleshooting integration issues.A proven track record as a Splunk Architect or Consultant and deep knowledge of Splunk...

Meet the Team Drives technical leadership and innovation within the Splunk security ecosystem, serving as a trusted advisor for sophisticated, multi-functional security initiatives at regional and global scale. Leads the compose, planning, and delivery of tailored Splunk solutions—including SIEM, SOAR, and AI-driven security operations—that address...

Are you looking to design and deliver enterprise-level solutions?Do you enjoy collaborating with customers, internal teams, and project stakeholders to implement and optimize Splunk solutions?Want to be part of a leading global software and cloud solutions provider, helping organizations run and optimize their IT environments?Practical InformationLocation:...

Soitron Siber Güvenlik Servisleri A.Ş. İstanbul’da SOC Analisti arıyor. Pozisyon, Void SOC bünyesinde Türkiye’deki SOC müdürüne bağlı olarak çalışacaktır ve 7x24 vardiya ile altyapıları izlemek üzere tasarlanmıştır.İşe alınacak aday, 1 yıl deneyime sahip olabilir ve QRadar/Splunk/XSOAR gibi çözümlere ilgi gösterecektir. İyi...

Practical Information Location: Istanbul, Turkey | Reports to: CTO | Work Arrangement: Hybrid | Visa Requirements: Valid working visa for Turkey | Language Requirements: Good command of English, written and spoken Key Responsibilities Design and implement scalable Splunk architectures based on customer requirements Lead Splunk deployment, configuration,...

Istanbul • Soitron Siber Güvenlik Servisleri / SOC • Tam ZamanlıSoitronekibinekatılaraksibergüvenliktekariyeryapmakisteyenadaylarınbaşvurularınıbekliyoruz.Soitron Siber Güvenlik Servisleri A.Ş.,Avrupa merkezli bilgi teknolojileri firması Soitron Group'un Türkiye’deki siber güvenlik şirketidir. Soitron olarak müşterilerimize kapsamlı...

Executive SummaryTreomind seeks a senior AI Security Operations Engineer responsible for continuous monitoring, detection, response, governance, and operational security of enterprise AI systems. The role combines AI Security, SOC operations, cloud security, threat detection, telemetry analysis, dashboarding, and consulting expertise.Core MissionMonitor AI...

Talentra teknoloji projeleri yürüten müşteriler için SOC Incident Response & Digital Forensics Engineer L3 aranıyor. Aday, olay müdahale yaşam döngüsünü baştan sona yönetmeli ve güvenlik olaylarını analiz ederek güvenliği artırmalıdır.Üniversite mezunu, 6–8 yıl deneyimli ve SPLUNK/QRadar gibi SIEM çözümlerinde yetkin olan adaylar...

Would you like to perform rewarding work while contributing to the success of an established, growing company?We are looking for a Senior Java Developer with expertise in payment systems to join our team and lead high-impact projects in the financial services domain.QualificationsBachelor’s degree in Computer Engineering, Software Engineering, Mathematics...

Türkiye’nin ilk dijital bankası: HAYAT FİNANS! 89 yıllık Hayat Holding güvencesini ve tecrübesini de arkamıza alarak, Türkiye’nin lisanslı ilk dijital bankası olarak sektörde öne çıkıyoruz. Katılım bankacılığı prensipleriyle sunduğumuz tüm ürün ve hizmetleri, dijital dünyada en iyi deneyim, en uygun maliyet ve en yüksek hızla...

Executive Summary Treomind seeks a senior AI Security Operations Engineer responsible for continuous monitoring, detection, response, governance, and operational security of enterprise AI systems. The role combines AI Security, SOC operations, cloud security, threat detection, telemetry analysis, dashboarding, and consulting expertise. Core Mission Monitor...

Farklı sektörlerde teknoloji projeleri geliştiren müşterimiz için "SOC Incident Response & Digital Forensics Engineer L3" aramaktayız.Üniversitelerin ilgili bölümlerinden mezun olmak.SOC operasyonları, Incident Response veya Dijital Adli Bilişim alanlarında 6–8 yıl deneyime sahip olmak.Olay müdahale yaşam döngüsüne hâkim olmak....

Bir Tera Grup kuruluşu olan Barikat Siber Güvenlik olarak; güvenlik operasyonları merkezi (SOC) hizmetlerinden danışmanlık ve uyumluluk denetimine, teknik destekten Ar-Ge kaynaklı özgün ürünlerimize kadar geniş bir yelpazede kurumlara uçtan uca siber güvenlik çözümleri sunmaktayız.Giderek karmaşıklaşan dijital tehdit ortamında,...

Üniversitelerin mühendislik bölümlerinden mezun,SIEM ve SOAR teknolojileri üzerinde en az 5 yıl deneyimli,Log yönetimi, korelasyon kuralları ve alarm optimizasyonu konusunda bilgi sahibi,Use case geliştirme ve mevcut kuralların iyileştirilmesi konusunda deneyimli,Incident Response süreçlerine hakim,Playbook ve otomasyon geliştirme konusunda...

We are looking for DevOps Engineer to join our fast-paced and self-accountable team that delivers enterprise-level products for local and global markets. You will work with IT consultants, delivery managers, QA teams, BE, FE, and mobile developers to deliver best-in-class digital products. where you can code, grow, and inspire others. What will you...

iyzico iyzico was founded in 2013 to provide online payment services and artificial intelligence-based payment technologies to businesses of various sizes in the world of e-commerce. By making the complex payment processes simple through its easy and secure platform, iyzico had achieved significant successes through supporting thousands of businesses in...

## Senior DevOps Engineer (Offer Engineering)Applyremote type: Hybridlocations: Istanbultime type: Full timeposted on: Posted 3 Days Agotime left to apply: End Date: August 17, 2026 (16 days left to apply)job requisition id: R33530**Job Title**Senior DevOps Engineer (Offer Engineering)**Amadeus** is the leading technology provider to the travel...

Platin Bilişim olarak, Siber Güvenlik Operasyon Merkezi (SOC) ekibimizde görev alacak SOC L1 Analisti ekip arkadaşımızı arıyoruz. Siber güvenlik alanında kariyerine güçlü bir başlangıç yapmak, gerçek güvenlik olaylarını analiz ederek kendini geliştirmek ve uzmanlaşmak istiyorsan seni ekibimize bekliyoruz.Üniversitelerin Mühendislik,...

Job Title Senior DevOps Engineer (Offer Engineering) Amadeus is the leading technology provider to the travel industry and is present in 190+ countries around the world. Our innovative solutions power every part of a traveler’s journey, from airlines to search engines, travel agencies to hotels, the world's top travel brands rely on Amadeus to help create...